PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10036761
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 382aa    MW: 42998.6 Da    PI: 5.8937
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10036761genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF53.92.3e-171053245
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                 + en+  rq t+ kR++g++KKA+EL +LCd+   +++fs+tgk
  Lus10036761 10 KLENTNGRQATYGKRKHGMMKKASELAILCDIPLILLMFSPTGK 53
                 6799**************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.7E-23160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006622.175153IPR002100Transcription factor, MADS-box
CDDcd002664.66E-22283No hitNo description
SuperFamilySSF554558.37E-23294IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-14323IPR002100Transcription factor, MADS-box
PfamPF003196.2E-161154IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-142338IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-143859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MGRVKLKIKK LENTNGRQAT YGKRKHGMMK KASELAILCD IPLILLMFSP TGKPALCKGK  60
RSIEEVMSKF AQLAPQERTK RKMESLEALK KTFKKLDHDV NIQEFLGTRL VSLCETSIDQ  120
DLENQSNLLK NQLSETYKRL NYWENLDKVD SIELLGQMEN SVQESLSRIQ EHKNNLGKQQ  180
IGSLECNSQF QDEMQVPFGM NTEQQQFPPF QWLSNCDPQH IVFPDDHNLL SHRDVECSAS  240
SSCGGYSGYF YPGKGSDLSN SGQESGVSCS LNELNGNASL RMQLTGQYPF FPYNLNLLDD  300
RKFQPAVAEM SLLQESAVDF NVNGSFEAPK PGYCNTPGSW ASTSGPCTVR TMFDDQLYSQ  360
VQHLVEFEQC CDPVYSCTTH T*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011017353.11e-172PREDICTED: MADS-box protein CMB1-like isoform X2
TrEMBLA0A067KYG71e-176A0A067KYG7_JATCU; Uncharacterized protein
STRINGPOPTR_0008s08780.11e-169(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27503370
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.22e-83AGAMOUS-like 30